PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462930534
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 178aa    MW: 20243.6 Da    PI: 8.6196
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462930534genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.83e-1610781786
               E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
               +l + f++++g+ k++++ l+    s r W+v+   r + ++y+++ GWk+F+++n LkegD+++F +++
  462930534 10 SLARAFCDAIGLLKPCTIILKTSVDSTRYWQVQGA-RYNNSSYTIQLGWKRFCQENSLKEGDICTFNVIE 78
               6899*******9999976666666788*******3.333345************************9775 PP

2B349.66.9e-16971711593
                -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  +lp  f++ +g+ +++ +tl+   +s  sW  ++   k+ ++ + ++GWk+F+++n+LkegD+++F+++   e++l+
  462930534  97 SYSLPLAFCAGIGLREPCRITLKTSMSSCMSWLARVAPYKY-CSQMGGSGWKRFCQDNDLKEGDVCTFHVT---ETTLW 171
                568************99998888777888*******65555.45689**********************53...33344 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.182190IPR003340B3 DNA binding domain
SMARTSM010190.013390IPR003340B3 DNA binding domain
PfamPF023621.5E-121084IPR003340B3 DNA binding domain
SuperFamilySSF1019364.71E-151189IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-161188IPR015300DNA-binding pseudobarrel domain
CDDcd100174.75E-91374No hitNo description
SMARTSM010190.03193178IPR003340B3 DNA binding domain
PfamPF023627.9E-1494175IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-1596177IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.83E-1696177IPR015300DNA-binding pseudobarrel domain
CDDcd100171.04E-1099177No hitNo description
PROSITE profilePS5086310.574100178IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MVIGASIGES LARAFCDAIG LLKPCTIILK TSVDSTRYWQ VQGARYNNSS YTIQLGWKRF  60
CQENSLKEGD ICTFNVIETT LWHVVIMRCK EKINQFSYSL PLAFCAGIGL REPCRITLKT  120
SMSSCMSWLA RVAPYKYCSQ MGGSGWKRFC QDNDLKEGDV CTFHVTETTL WHVIIVRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975299.18e-28PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X2
TrEMBLA0A0A9S1934e-45A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012066m1e-34(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.12e-10B3 family protein